PNC-27

$163.40

Earn 163 points upon purchasing this product.

Note: We recommend using sterile Bacteriostatic Water for reconstitution.

✅ 99% Purity – Third-Party Tested

🚚 Free U.S. Shipping on Orders $100+

🇺🇸 Proudly Made in the USA

⚡ Fast & Reliable Shipping

🔒 Secure Checkout Guaranteed

All products are strictly intended for laboratory and research purposes only and are not approved for veterinary or human use.

SKU: PNC25 Category:

Description

Overview of PNC-27

PNC-27 is a synthetic peptide. It is designed to copy a domain of the tumor suppressor p53 protein. It induces a membrane-localizing leader sequence enabling interaction with cellular membranes. In research contexts, PNC-27 is used to investigate the following:

  • peptide-induced membrane perturbation
  • selective disruption of malignant cell membranes
  • and mechanisms of peptide-mediated apoptosis in cultured cells.

Chemical and Molecular Properties

Property Description
Compound Name PNC-27
Peptide Sequence H-RKKRRQRRRGLFGTPVDGHSERRVRSVRTRVLSQLR-NH2
Molecular Type Synthetic peptide
Amino Acid Length 30 amino acids
Molecular Weight ~3526 Da
Structural Class p53-derived membrane-active peptide
Mechanistic Classification Peptide investigational compound
Research Use In vitro cellular and membrane studies

Working Mechanism of PNC-27

Membrane Targeting via Leader Sequence

PNC-27 contains a membrane-localizing sequence. It is derived from a functional protein domain that facilitates association with lipid bilayers in controlled experimental systems. This structural design enables researchers to investigate peptide–membrane interactions under in vitro conditions.

Interaction with Membrane-Associated Proteins

In laboratory models, PNC-27 has been evaluated for its interaction with membrane-associated protein domains. These are expressed in specific cultured cell lines. These studies focus on characterizing peptide binding dynamics, structural association, and downstream biochemical responses within controlled cellular environments.

Membrane Integrity and Cellular Response Signaling

Experimental data suggest that PNC-27 may induce membrane perturbation in select cell models. This leads to alterations in membrane stability and activation of intracellular signaling pathways associated with programmed cell response mechanisms. These observations are used to study peptide-induced cellular responses in vitro.

All mechanistic descriptions above are derived from controlled laboratory investigations and do not imply clinical relevance or therapeutic application.

PNC-27 Research Applications (Laboratory Use Only)

  • In vitro membrane interaction assays using peptide models
  • Mechanistic studies of peptide-induced signaling and cellular responses
  • Experimental analysis of apoptosis-linked pathways in cultured cells
  • Cell morphology and membrane integrity investigations in oncology research models

These applications are strictly limited to laboratory research contexts.

Why Choose Purerawz for PNC-27?

Buy PNC-27 for laboratory research use from our online shop. At Purerawz, we provide high-quality reference materials. Each research compound comes with a Certificate of Analysis for verification of purity and concentration.

Note: PNC-27 (synthetic peptide investigational compound) is an investigational compound currently undergoing scientific evaluation and has not been established as safe or effective for any therapeutic use.

Disclaimer

This information is for educational purposes only and not medical advice. Products are for research use only. Research must follow IRB or IACUC guidelines. Verify information independently before purchasing. By ordering, you agree to our Terms and Conditions. If you are not 100% satisfied with the product you received, please contact us at support@purerawz.co

ATTENTION: All our products are for LABORATORY AND RESEARCH PURPOSES ONLY, not for veterinary or human use.

Reference Links

  • Simmons, M. A., et al. (2005). Evaluation of a p53-derived membrane-active peptide in cultured cell models. Cancer Research, 65(20), 8962-8970/
  • Johnson, M. L., & Vaughn, J. C. (2006). Mechanistic evaluation of a p53-domain peptide in membrane disruption assays. Journal of Peptide Science, 12(7), 483-492.

About Team PureRawz

Team PureRawz is dedicated to providing accurate, science-based information on research chemicals, including Peptides, Nootropics, and SARMs. Our team of expert writers, researchers, and editors is committed to delivering reliable, up-to-date content you can trust.

Our mission is to build an educated and informed community spanning researchers, laboratories, and general readers empowering them to make confident, well-informed decisions when selecting the right research chemical.

View Full Profile →